missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC22A12 Partial ORF (NP_653186.2, 281 a.a. - 349 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00116085-Q02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131507

  • 3343.96 SEK / 10µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a urate transporter and urate-anion exchanger which regulates the level of urate in the blood. This protein is an integral membrane protein primarily found in kidney. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
Specifications

Specifications

NP_653186.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.33kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
RUO
SLC22A12
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
116085
SLC22A12 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OAT4L/RST/URAT1
SLC22A12
Yes
Videos
SDS
Documents
Certificates