missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC29A4 Partial ORF (NP_694979, 283 a.a. - 345 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00222962-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182517

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is a member of the SLC29 family and encodes a plasma membrane protein with 11 transmembrane helices. This protein catalyzes the reuptake of monoamines into presynaptic neurons, thus determining the intensity and duration of monoamine neural signaling. It has been shown to transport several compounds, including serotonin, dopamine, and the neurotoxin 1-methyl-4-phenylpyridinium. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq]

Sequence: VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Specifications

Specifications

NP_694979
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.67kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
RUO
SLC29A4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
222962
SLC29A4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ENT4/FLJ34923/PMAT
SLC29A4
Yes
Videos
SDS
Documents
Certificates