missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC2A9 Partial ORF (NP_001001290, 224 a.a. - 287 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056606-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16178756

  • 5030.41 SEK / 25µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQ
Specifications

Specifications

NP_001001290
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.78kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPYVRWQ
RUO
SLC2A9
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
56606
SLC2A9 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GLUT9/GLUTX/UAQTL2/URATv1
SLC2A9
Yes
Videos
SDS
Documents
Certificates