Learn More
Abnova™ Human SLC5A2 Partial ORF (NP_003032.1, 228 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006524-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. [provided by RefSeq]
Sequence: GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPSpecifications
NP_003032.1 | |
Liquid | |
6524 | |
SLC5A2 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
SGLT2 | |
SLC5A2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.24kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP | |
RUO | |
SLC5A2 | |
Wheat Germ (in vitro) | |
GST |