missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30194030

Invitrogen™ Human SLC7A7 (aa 3-35) Control Fragment Recombinant Protein

Produktkod. 30194030
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30194030

Brand: Invitrogen™ RP95664

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57574 (PA5-57574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9UM01
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 9056
Namn Human SLC7A7 (aa 3-35) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias AI790233; amino acid transporter SLC7A7 y+LAT1; LAT3; LPI; monocyte amino acid permease 2; MOP-2; my+lat1; Slc7a7; solute carrier family 7 (amino acid transporter light chain, y+L system), member 7; solute carrier family 7 (cationic amino acid transporter, y+ system), member 7; solute carrier family 7 member 7; y(+)L-type amino acid transporter 1; Y+L amino acid transporter 1; Y+L amino acid transporter 1; solute carrier family 7 member 7; y+LAT1; y+LAT-1
Vanligt namn SLC7A7
Gensymbol SLC7A7
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.