missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SMN2 Partial ORF (NP_059107, 191 a.a. - 294 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006607-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135525

  • 3343.96 SEK / 10µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene is part of a 500kb inverted duplication on chromosome 5q13 which contains at least 4 genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. While mutations in telomeric copy are associated with spinal muscular atrophy, the centromeric copy do not lead to disease. This gene may be a modifier of disease caused by mutation in telomeric copy. The critical seq difference between two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. 9 exons of both telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The full length protein encoded by this gene localizes to both cytoplasm and nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems found near coiled bodies containing high concentrations of snRNPs. This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Four transcript variants encoding distinct isoforms have been described.

Sequence: NSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
Specifications

Specifications

NP_059107
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.18kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN
RUO
SMN2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6607
SMN2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BCD541/C-BCD541/FLJ76644/MGC20996/MGC5208/SMNC
SMN2
Yes
Videos
SDS
Documents
Certificates