missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SP7 Partial ORF (NP_690599, 87 a.a. - 162 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00121340-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16161637

  • 4055.00 SEK / 10µg
Estimated Shipment: 05-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

SP7 is a C2H2-type zinc finger transcription factor of the SP gene family and a putative master regulator of bone cell differentiation (Gao et al., 2004 [PubMed 15474293]).[supplied by OMIM]

Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH
Specifications

Specifications

NP_690599
Liquid
121340
SP7 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC126598/OSX/osterix
SP7
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.1kDa
12.5% SDS-PAGE Stained with Coomassie Blue
GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH
RUO
SP7
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers