missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30213300

Invitrogen™ Human SPARC (aa 174-301) Control Fragment Recombinant Protein

Produktkod. 30213300
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30213300 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30213300 Leverantör Invitrogen™ Leverantörsnummer RP100513
 Begränsad artikel
Beräknad leverans: 09-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82050. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SPARC gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P09486
Koncentration ≥5.0 mg/mL
För användning med (applikation) Neutralization, Control
Formulering PBS, 1M urea with no preservative; pH 7.4
Gen-ID (Entrez) 6678
Namn Human SPARC (aa 174-301) Control Fragment
pH-intervall 7.4
Reningsmetod Purified
Kvantitet 100 μL
Förvaringskrav -20°C, Avoid Freeze/Thaw Cycles
Regulatorisk status RUO
Gene Alias Basement membrane protein 40; basement-membrane protein 40; BM40; BM-40; Cysteine rich protein; OI17; ON; Osteonectin; osteonectin precursor; Secreted acidic cystein rich glycoprotein; secreted acidic cysteine rich glycoprotein; Secreted acidic cystein-rich glycoprotein (osteonectin); secreted protein acidic and cysteine rich; secreted protein acidic and rich in cysteine; Secreted protein acidic and rich in cysteine (SPARC); secreted protein, acidic, cysteine-rich (osteonectin); secreted protein, acidic, cysteine-rich [osteonectin]; SPARC
Vanligt namn SPARC
Gensymbol SPARC
Produkttyp Protein
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.