missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SRD5A2 Partial ORF (NP_000339.2, 28 a.a. - 65 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00006716-Q01.25ug
Additional Details : Weight : 0.02000kg
Description
This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq]
Sequence: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPASpecifications
| NP_000339.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 29.81kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA | |
| RUO | |
| SRD5A2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6716 | |
| SRD5A2 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC138457 | |
| SRD5A2 | |
| Recombinant | |
| wheat germ expression system |