missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ST13 Full-length ORF (AAH15317, 1 a.a. - 58 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006767-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131052

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene. [provided by RefSeq]

Sequence: MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
Specifications

Specifications

AAH15317
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.12kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AAG2/FAM10A1/FAM10A4/FLJ27260/HIP/HOP/HSPABP/HSPABP1/MGC129952/P48/PRO0786/SNC6
ST13
Yes
wheat germ expression system
Liquid
6767
ST13 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF
RUO
ST13
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates