missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30196589

Invitrogen™ Human STARD13 (aa 132-216) Control Fragment Recombinant Protein

Produktkod. 30196589
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30196589

Brand: Invitrogen™ RP104223

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63622 (PA5-63622. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which contains an N-terminal sterile alpha motif (SAM) for protein-protein interactions, followed by an ATP/GTP-binding motif, a GTPase-activating protein (GAP) domain, and a C-terminal STAR-related lipid transfer (START) domain. It may be involved in regulation of cytoskeletal reorganization, cell proliferation, and cell motility, and acts as a tumor suppressor in hepatoma cells. The gene is located in a region of chromosome 13 that is associated with loss of heterozygosity in hepatocellular carcinomas. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9Y3M8
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 90627
Namn Human STARD13 (aa 132-216) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 46H23.2; ARHGAP37; deleted in liver cancer 2 protein; DLC2; DLC-2; GT650; LINC00464; long intergenic non-protein coding RNA 464; Rho GTPase activating protein on chromosome 13q12; Rho GTPase-activating protein; serologically defined colon cancer antigen 13; serologically defined colon cancer antigen 28; STA13; StAR related lipid transfer domain containing 13; STARD13; StAR-related lipid transfer (START) domain containing 13; StAR-related lipid transfer domain containing 13; stAR-related lipid transfer protein 13; START domain-containing protein 13
Vanligt namn STARD13
Gensymbol STARD13
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens DSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCC
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.