missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human STK4 Partial ORF (NP_006273, 391 a.a. - 485 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006789-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136045

  • 3343.96 SEK / 10µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. [provided by RefSeq]

Sequence: AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
Specifications

Specifications

NP_006273
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.19kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ
RUO
STK4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6789
STK4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686A2068/KRS2/MST1/YSK3
STK4
Yes
Videos
SDS
Documents
Certificates