missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SV2A Partial ORF (NP_055664, 474 a.a. - 530 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009900-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16131436

  • 6150.00 SEK / 25µg
Estimated Shipment: 14-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL
Specifications

Specifications

NP_055664
Liquid
9900
SV2A (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0736/SV2
SV2A
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
32.01kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HLQAVDYASRTKVFPGERVGHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSL
RUO
SV2A
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers