missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TACR1 Partial ORF (NP_001049.1, 309 a.a. - 407 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006869-Q02.10ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16064785

  • 3234.00 SEK / 10µg


Estimated Shipment
09-02-2021
Add to basket

Description

Description

This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. The encoded protein is also involved in the mediation of phosphatidylinositol metabolism of substance P. [provided by RefSeq]

Sequence: NDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
Specifications

Specifications

NP_001049.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
RUO
TACR1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
6869
TACR1 (Human) Recombinant Protein (Q02)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NK1R|NKIR|SPR|TAC1R
TACR1
Yes
Videos
SDS
Documents