missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TBX3 Partial ORF (NP_005987, 311 a.a. - 410 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4515.00 SEK - 6845.00 SEK

Specifications

Accession Number NP_005987
For Use With (Application) Antibody Production, ELISA, Protein Array, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 6926
Molecular Weight (g/mol) 36.74kDa
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16014815
View Documents Promotion Details
Abnova™
H00006926-Q01.25UG
25 ug
6845.00 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 27-03-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
16004815
View Documents Promotion Details
Abnova™
H00006926-Q01.10UG
10 ug
4515.00 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 27-03-2024
to see stock.
Please to purchase this item. Need a web account? Register with us today!
Description

Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq]

Sequence: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Specifications

Specifications

NP_005987
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TBX3-ISO/UMS/XHL
TBX3
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
6926
TBX3 (Human) Recombinant Protein (Q01)
KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
RUO
TBX3
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documents

Documents

Product Certifications