missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30194178

Invitrogen™ Human TCP-1 zeta (aa 28-63) Control Fragment Recombinant Protein

Produktkod. 30194178
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30194178 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30194178 Leverantör Invitrogen™ Leverantörsnummer RP104391

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61036 (PA5-61036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein TCP-1 (t complex polypeptide 1) is a subunit of the heterooligomeric complex CCT (chaperonin containing TCP-1) present in the eukaryotic cytosol. The CCT of eukaryotic cytosol is composed of eight different subunit species, TCP-1 alpha, beta, gamma, delta, epsilon, zeta, eta and theta, each encoded by a different gene. Two zeta subunits have been described: TCP-1 zeta (also designated TCP-1 zeta1) and TCP-1 zeta2. TCP-1 subunits are proposed to have independent functions in folding its in vivo substrates, the actins and tubulins. TCP-1 was first identified in the mouse as relevant for tail-less and embryonic lethal phenotypes. Sequences homologous to TCP-1 have been isolated in several other species, and the yeast TCP-1 has been shown to encode a molecular chaperone for Actin and Tubulin. TCP-1 found in mammalian cells and yeast plays an important role in the folding of cytosolic proteins.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P40227
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 908
Namn Human TCP-1 zeta (aa 28-63) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias acute morphine dependence related protein 2; acute morphine dependence-related protein 2; amino acid transport defect-complementing; CCT zeta1; CCT- zeta1; CCT- zeta-1; CCT zeta-1; Cct6; Cct6a; Cctz; Cctz1; Cctz-1; CCT-zeta; CCT-zeta-1; chaperonin containing T-complex subunit 6; chaperonin containing TCP-1; chaperonin containing TCP1 subunit 6 A; chaperonin containing Tcp1, subunit 6 A (zeta 1); chaperonin containing Tcp1, subunit 6 A (zeta); chaperonin subunit 6 A (zeta); histidine transp; histidine transport regulator 3; HTR3; MoDP-2; T-complex protein 1 subunit zeta; T-complex protein 1, zeta subunit; TCP 1 zeta; TCP1 zeta; TCP-1- zeta; TCP1- zeta; TCP-1-zeta; Tcp20; TCPZ; TTCP20
Vanligt namn TCP-1 zeta
Gensymbol CCT6A
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens RGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVL
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.