missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30213062

Invitrogen™ Human THAP11 (aa 7-65) Control Fragment Recombinant Protein

Produktkod. 30213062
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30213062 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30213062 Leverantör Invitrogen™ Leverantörsnummer RP109292
 Begränsad artikel
Beräknad leverans: 03-11-2026
Lägg i varukorgen
Lägg i varukorgen

missing translation for 'validMainframeMsg'

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes two proteins, the SART1protein expressed in the nucleus of the majority of proliferating cells, and the SART1protein expressed in the cytosol of epithelial cancers. The SART1protein is translated by the mechanism of -1 frameshifting during posttranscriptional regulation; its full-length sequence is not published yet. The two encoded proteins are thought to be involved in the regulation of proliferation. Both proteins have tumor-rejection antigens. The SART1protein possesses tumor epitopes capable of inducing HLA-A2402-restricted cytotoxic T lymphocytes in cancer patients. This SART1antigen may be useful in specific immunotherapy for cancer patients and may serve as a paradigmatic tool for the diagnosis and treatment of patients with atopy. The SART1protein is found to be essential for the recruitment of the tri-snRNP to the pre-spliceosome in the spliceosome assembly pathway.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q96EK4
Koncentration ≥5.0 mg/mL
För användning med (applikation) Neutralization, Control
Formulering PBS, 1M urea with no preservative; pH 7.4
Gen-ID (Entrez) 57215
Namn Human THAP11 (aa 7-65) Control Fragment
pH-intervall 7.4
Reningsmetod Purified
Kvantitet 100 μL
Förvaringskrav -20°C, Avoid Freeze/Thaw Cycles
Regulatorisk status RUO
Gene Alias 2810036E22Rik; AB041579; CTG-B43a; CTG-B45d; HRIHFB2206; MNCb-2032; Ronin; THAP domain containing 11; THAP domain-containing protein 11; Thap11
Vanligt namn THAP11
Gensymbol THAP11
Produkttyp Protein
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens CVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHF
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.