missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TIAF1 Partial ORF (NP_004731, 1 a.a. - 115 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009220-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16180186

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
Specifications

Specifications

NP_004731
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.39kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
RUO
TIAF1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
9220
TIAF1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MAJN/MYO18A/MYSPDZ/SPR210
TIAF1
Yes
Videos
SDS
Documents
Certificates