missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TIMM8B Partial ORF (NP_036591, 1 a.a. - 83 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | NP_036591 |
|---|---|
| For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 26521 |
| Molecular Weight (g/mol) | 34.87kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16105536
|
Abnova™
H00026521-Q01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 22-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16115536
|
Abnova™
H00026521-Q01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 22-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma
Sequence: MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQSpecifications
| NP_036591 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.87kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DDP2/FLJ21744/MGC102866/MGC117373/TIM8B | |
| TIMM8B | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 26521 | |
| TIMM8B (Human) Recombinant Protein (Q01) | |
| MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ | |
| RUO | |
| TIMM8B | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |