missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30205610

Invitrogen™ Human TIMP1 (aa 128-200) Control Fragment Recombinant Protein

Produktkod. 30205610
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30205610

Brand: Invitrogen™ RP103156

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIMP1 (metalloproteinase inhibitor 1) is a metalloproteinase inhibitor that functions by forms one-to-one complexes with target metallproteinases, such as collagenases, and irreversible inactivates them by binding to their catalytic zinc cofactor. TIMP1 acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP14, and MMP16. It also functions as a growth factor that regulates cell differenation, migration, and cell death. TIMP1 activates cellular signaling cascades via CD63 and ITGB1.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P01033
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 7076
Namn Human TIMP1 (aa 128-200) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias CLGI; collagenase inhibitor; Collagenase inhibitor 16C8 fibroblast; EG-1; Embryogenin-1; EPA; EPO; erythroid potentiating activity; erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Metalloproteinase inhibitor; metalloproteinase inhibitor 1; metalloproteinase tissue inhibitor; metalloproteinase tissue inhibitor 1; MMP inhibitor; RP1-230G1.3; Timp; TIMP 1; TIMP metallopeptidase inhibitor 1; TIMP1; TIMP-1; TIMP-1 protein; tissue inhibitor of matrix metalloproteinase-1; tissue inhibitor of metal proteinases; tissue inhibitor of metallopeptidase 1; tissue inhibitor of metalloproteinase; tissue inhibitor of metalloproteinase 1; tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor); tissue inhibitor of metalloproteinase-1; tissue inhibitor of metalloproteinases; tissue inhibitor of metalloproteinases 1; TPA-induced protein; TPA-S1
Vanligt namn TIMP1
Gensymbol TIMP1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.