missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TMEM167B Full-length ORF (NP_064526.1, 1 a.a. - 74 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056900-P02.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132313

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK
Specifications

Specifications

NP_064526.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.54kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AD-020/C1orf119/FLJ90710
TMEM167B
Yes
wheat germ expression system
Liquid
56900
TMEM167B (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue
MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYVLFIK
RUO
TMEM167B
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates