missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TMSB4X Full-length ORF (NP_066932, 1 a.a. - 44 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007114-P02.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181452

  • 3343.96 SEK / 10µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq]

Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Specifications

Specifications

NP_066932
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
30.58kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FX/PTMB4/TB4X/TMSB4
TMSB4X
Yes
wheat germ expression system
Liquid
7114
TMSB4X (Human) Recombinant Protein (P02)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
RUO
TMSB4X
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates