missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TNFRSF11A Partial ORF (NP_003830, 31 a.a. - 130 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008792-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16119265

  • 5854.80 SEK / 25µg
Estimated Shipment: 18-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptors can interact with various TRAF family proteins, through which this receptor induces the activation of NF-kappa B and MAPK8/JNK. This receptor and its ligand are important regulators of the interaction between T cells and dendritic cells. This receptor is also an essential mediator for osteoclast and lymph node development. Studies of the mouse counterpart suggest that this receptor directly mediates the osteoprotegerin ligand (OPGL)-induced osteoclastogenesis in osteoclast precursor cells. [provided by RefSeq]

Sequence: APPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRN
Specifications

Specifications

NP_003830
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
APPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRN
RUO
TNFRSF11A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8792
TNFRSF11A (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CD265/FEO/LOH18CR1/ODFR/OFE/OPTB7/OSTS/PDB2/RANK/TRANCER
TNFRSF11A
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers