missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human TNFRSF14 (aa 3-100) Control Fragment Recombinant Protein

Produktkod. 30199251
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30199251

Brand: Invitrogen™ RP88848

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TNFRSF14 is a member of the TNF-receptor superfamily. TNFRSF14 was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to TNFRSF14 has been shown to be part of the viral entry mechanism. The cytoplasmic region of TNFRSF14 was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. Activation of the signal transduction pathway involving TNFRSF14 in T cells stimulates T cell proliferation and cytokine production, leading to inflammation and enhanced CTL-mediated tumor immunity, suggesting that these proteins may be useful as potential targets for controlling cellular immune responses. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these TNFRSF14 variants have not been determined.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q92956
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 8764
Namn Human TNFRSF14 (aa 3-100) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias Atar; CD270; CD40-like protein; herpes virus entry mediator; herpes virus entry mediator A; Herpesvirus entry mediator A; HGNC:11912; HVEA; Hvem; LIGHTR; RP3-395M20.6; sCD2710; TNF receptor superfamily member 14; Tnfrs14; TNFRSF14; TR2; tumo; Tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); Tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; UNQ329/PRO509
Vanligt namn TNFRSF14 (HVEM)
Gensymbol TNFRSF14
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens PPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.