missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TNK2 Partial ORF (AAH08884, 21 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010188-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16132056

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Sequence: QYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
Specifications

Specifications

AAH08884
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCL
RUO
TNK2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10188
TNK2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ACK/ACK1/FLJ44758/FLJ45547/p21cdc42Hs
TNK2
Yes
Videos
SDS
Documents
Certificates