missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TPBG Partial ORF (NP_006661, 219 a.a. - 328 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007162-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16176875

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
Specifications

Specifications

NP_006661
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEK
RUO
TPBG
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7162
TPBG (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
5T4/5T4-AG/M6P1
TPBG
Yes
Videos
SDS
Documents
Certificates