missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TPD52 Partial ORF (NP_005070, 100 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007163-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136885

  • 5030.41 SEK / 25µg

Estimated Shipment: 14-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
Specifications

Specifications

NP_005070
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.09kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
RUO
TPD52
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7163
TPD52 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
D52/N8L/PC-1/PrLZ/hD52
TPD52
Yes
Videos
SDS
Documents
Certificates