missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30207836

Invitrogen™ Human TPI1 (aa 66-141) Control Fragment Recombinant Protein

Produktkod. 30207836
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30207836

Brand: Invitrogen™ RP104971

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84161 (PA5-84161. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme, consisting of two identical proteins, which catalyzes the isomerization of glyceraldehydes 3-phosphate and dihydroxy-acetone phosphate in glycolysis and gluconeogenesis. Mutations in this gene are associated with triosephosphate isomerase deficiency. Pseudogenes have been identified on chromosomes 1, 4, 6 and 7. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P60174
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 7167
Namn Human TPI1 (aa 66-141) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias AI255506; epididymis secretory protein Li 49; HEL-S-49; Methylglyoxal synthase; MGC88108; TIM; Tpi; TPI1; Tpi-1; TPID; triosephosphate isomerase; triose-phosphate isomerase; triosephosphate isomerase 1; triose-phosphate isomerase TPI1; unnamed protein product; YD9609.05 C; YDR050C
Vanligt namn TPI1
Gensymbol Tpi1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens NCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITE
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.