missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TPRT Partial ORF (NP_055132, 343 a.a. - 415 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023590-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency. [provided by RefSeq]
Sequence: FPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDKSpecifications
| NP_055132 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.77kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| FPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK | |
| RUO | |
| PDSS1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 23590 | |
| TPRT (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| COQ1/DPS/MGC70953/RP13-16H11.3/SPS/TPRT/TPT/hDPS1 | |
| PDSS1 | |
| Recombinant | |
| wheat germ expression system |