missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30208380

Invitrogen™ Human TR2 (aa 289-372) Control Fragment Recombinant Protein

Produktkod. 30208380
Change view
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkod. Kvantitet
30208380 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denna artikel kan inte returneras. Se returpolicy
Produktkod. 30208380 Leverantör Invitrogen™ Leverantörsnummer RP104652

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear hormone receptor characterized by a highly conserved DNA binding domain (DBD), a variable hinge region, and a carboxy-terminal ligand binding domain (LBD) that is typical for all members of the steroid/thyroid hormone receptor superfamily. This protein also belongs to a large family of ligand-inducible transcription factors that regulate gene expression by binding to specific DNA sequences within promoters of target genes. Multiple alternatively spliced transcript variants have been described, but the full-length nature of some of these variants has not been determined.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer P13056
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 7181
Namn Human TR2 (aa 289-372) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 4831444H07Rik; 80.3; 80-3 cNDA; ATAR; CD270; CD40-like protein; early embryonic nuclear receptor; Eenr; herpes virus entry mediator A; Herpesvirus entry mediator A; HVEA; HVEM; LIGHTR; mTR2; nr2c1; Nuclear receptor subfamily 2 group C member 1; nuclear receptor subfamily 2, group C isoform; nuclear receptor subfamily 2, group C, member 1; nuclear receptor subfamily 2, group H, member 1; orphan nuclear receptor TR2; orphan receptor, TR2-11; pregnancy specific beta-1-glycoprotein 4; Psg4; testicular receptor 2; TNF receptor superfamily member 14; TNFRSF14; Tr2; TR2 nuclear hormone receptor; Tr2-11; Tumor necrosis factor receptor superfamily member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); Tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; UNQ329/PRO509
Vanligt namn TR2
Gensymbol Nr2c1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens SQNSNEMSMIESLSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSINYTEKEGPLLSDS
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.