missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIM11 Partial ORF (NP_660215.1, 132 a.a. - 230 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00081559-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16035695

  • 6845.00 SEK / 25µg
Estimated Shipment: 02-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to the nucleus and the cytoplasm. Its function has not been identified. [provided by RefSeq]

Sequence: AEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIA
Specifications

Specifications

NP_660215.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AEDLKAKLEKSLEHLRKQMQDALLFQAQADETCVLWQKMVESQRQNVLGEFERLRRLLAEEEQQLLQRLEEEELEVLPRLREGAAHLGQQSAHLAELIA
RUO
TRIM11
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
81559
TRIM11 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BIA1/RNF92
TRIM11
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers