missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRIM36 Full-length ORF (NP_001017397.1, 1 a.a. - 60 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00055521-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121523

  • 6150.00 SEK / 25µg
Estimated Shipment: 11-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq]

Sequence: MSESGEMSEFGYIMELIAKGKMPDWRRGYRCRQGCGKTTELATATDFSQTGNKSGKHFKT
Specifications

Specifications

NP_001017397.1
Liquid
55521
TRIM36 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSESGEMSEFGYIMELIAKGKMPDWRRGYRCRQGCGKTTELATATDFSQTGNKSGKHFKT
RUO
TRIM36
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.1kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HAPRIN/RBCC728/RNF98
TRIM36
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers