missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human TRPV3 Partial ORF (NP_659505, 681 a.a. - 790 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00162514-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16122267

  • 3860.70 SEK / 10µg
Estimated Shipment: 27-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product belongs to a family of nonselective cation channels that function in a variety of processes, including temperature sensation and vasoregulation. The thermosensitive members of this family are expressed in subsets of sensory neurons that terminate in the skin, and are activated at distinct physiological temperatures. This channel is activated at temperatures between 22 and 40 degrees C. This gene lies in close proximity to another family member (TRPV1) gene on chromosome 17, and the two encoded proteins are thought to associate with each other to form heteromeric channels. [provided by RefSeq]

Sequence: VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
Specifications

Specifications

NP_659505
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGELCKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFEEVEEFPETSV
RUO
TRPV3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
162514
TRPV3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
VRL3
TRPV3
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers