missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human U2AF1L3 Partial ORF (NP_659424, 103 a.a. - 201 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00199746-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182367

  • 3343.96 SEK / 10µg

Estimated Shipment: 08-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSI
Specifications

Specifications

NP_659424
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSI
RUO
U2AF1L4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
199746
U2AF1L3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ35525/MGC33901/U2AF1-RS3/U2AF1L3/U2AF1L3V1/U2AF1RS3/U2af26
U2AF1L4
Yes
Videos
SDS
Documents
Certificates