missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UBE2Z Partial ORF (NP_075567, 136 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3860.70 SEK - 5854.80 SEK

Specifications

Name UBE2Z (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 35.64kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16149826
View Documents Promotion Details
Abnova™
H00065264-Q01.25UG
25 ug
5854.80 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 16-03-2022
Please to purchase this item. Need a web account? Register with us today!
16139826
View Documents Promotion Details
Abnova™
H00065264-Q01.10UG
10 ug
3860.70 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 16-03-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE2Z is an E2 enzyme (Jin et al., 2007 [PubMed 17597759]).[supplied by OMIM]

Sequence: IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA
Specifications

Specifications

UBE2Z (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
35.64kDa
SDS
Product Certifications