missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UCP1 Partial ORF (NP_068605, 232 a.a. - 267 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

3860.70 SEK - 5854.80 SEK

Specifications

Name UCP1 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 29.7kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16137255
View Documents Promotion Details
Abnova™
H00007350-Q01.25UG
25 ug
5854.80 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 07-03-2022
Please to purchase this item. Need a web account? Register with us today!
16127255
View Documents Promotion Details
Abnova™
H00007350-Q01.10UG
10 ug
3860.70 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 07-03-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]

Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
Specifications

Specifications

UCP1 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
29.7kDa
SDS
Product Certifications