missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UCP1 Partial ORF (NP_068605, 232 a.a. - 267 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007350-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137255

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. [provided by RefSeq]

Sequence: PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
Specifications

Specifications

NP_068605
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
29.7kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF
RUO
UCP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
7350
UCP1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
SLC25A7/UCP
UCP1
Yes
Videos
SDS
Documents
Certificates