missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human UNC5C Partial ORF (AAH41156, 498 a.a. - 597 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008633-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16118925

  • 3860.70 SEK / 10µg
Estimated Shipment: 20-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region. [provided by RefSeq]

Sequence: IKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMR
Specifications

Specifications

AAH41156
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.41kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMR
RUO
UNC5C
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8633
UNC5C (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
UNC5H3
UNC5C
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers