missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human V-ATPase C1 (aa 315-376) Control Fragment Recombinant Protein

Produktkod. 30194926
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
This item is not returnable. View return policy

Product Code. 30194926

missing translation for 'mfr': Invitrogen™ RP93831

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D.
TRUSTED_SUSTAINABILITY

Especificaciones

Tillträdesnummer P21283
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 528
Namn Human V-ATPase C1 (aa 315-376) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 1700025B18Rik; ATP6C; Atp6c1; ATP6D; Atp6v1c1; ATPase H+ transporting V1 subunit C1; ATPase, H+ transporting, lysosomal 42 kDa, V1 subunit C1; ATPase, H+ transporting, lysosomal V1 subunit C1; ATPase, H+ transporting, V1 subunit C, isoform 1; FLJ20057; H(+)-transporting two-sector ATPase, subunit C; H+ -ATPase C subunit; H+-transporting ATPase chain C, vacuolar; subunit C of vacuolar proton-ATPase V1 domain; testicular tissue protein Li 223; U13839; vacuolar ATP synthase subunit C; vacuolar H+ -ATPase C subunit; vacuolar proton pump C subunit; vacuolar proton pump subunit C 1; vacuolar proton pump, 42-kD subunit; vacuolar proton-ATPase, subunit C, VI domain; vatC; V-ATPase C subunit; V-ATPase subunit C 1; Vma5; V-type proton ATPase subunit C 1
Vanligt namn V-ATPase C1
Gensymbol ATP6V1C1
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens NFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDC
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado