missing translation for 'onlineSavingsMsg'
Läs mer
  1. Home
  2. Products
  3. Rekombinanta proteiner
  4. 30205366

Invitrogen™ Human V-ATPase H (aa 404-474) Control Fragment Recombinant Protein

Produktkod. 30205366
Klicka för att se tillgängliga alternativ
Kvantitet:
100 μL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30205366

Brand: Invitrogen™ RP93733

Vänligen för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54793 (PA5-54793. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular organelles. V-ATPase-dependent organelle acidification is necessary for multiple processes including protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. The encoded protein is the regulatory H subunit of the V1 domain of V-ATPase, which is required for catalysis of ATP but not the assembly of V-ATPase. Decreased expression of this gene may play a role in the development of type 2 diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Tillträdesnummer Q9UI12
Koncentration ≥5.0 mg/mL
För användning med (applikation) Blocking Assay, Control
Formulering 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 51606
Namn Human V-ATPase H (aa 404-474) Control Fragment
Kvantitet 100 μL
Regulatorisk status RUO
Gene Alias 0710001F19Rik; Atp6v1h; ATPase H+ transporting V1 subunit H; ATPase, H+ transporting, lysosomal 50/57 kDa, V1 subunit H; ATPase, H+ transporting, lysosomal V1 subunit H; AU022349; CGI-11; MSTP042; NBP1; Nef-binding protein 1; protein VMA13 homolog; SFD; SFDalpha; SFDbeta; vacuolar ATP synthase subunit H; vacuolar ATPase subunit H; vacuolar proton pump H subunit; vacuolar proton pump subunit H; Vacuolar proton pump subunit SFD; V-ATPase 50/57 kDa subunits; V-ATPase H subunit; V-ATPase subunit H; VMA13; V-type proton ATPase subunit H
Vanligt namn V-ATPase H
Gensymbol ATP6V1H
Konjugera Unconjugated
Art Human
Rekombinant Recombinant
Protein Tag His-ABP-tag
Sekvens PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE
Innehåll och lagring -20°C, Avoid Freeze/Thaw Cycles
Uttryckssystem E. coli
Form Liquid
Renhet eller kvalitetsklass >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.