missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human WBSCR22 Partial ORF (NP_059998.2, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00114049-Q01.25ug

Additional Details : Weight : 0.02000kg

 View more versions of this product

Product Code. 16055755

  • 4865.00 SEK / 25µg


Estimated Shipment
12-02-2021
Add to basket

Description

Description

This gene encodes a protein containing a nuclear localization signal and an S-adenosyl-L-methionine binding motif typical of methyltransferases, suggesting that the encoded protein may act on DNA methylation. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. [provided by RefSeq]

Sequence: MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIP
Specifications

Specifications

NP_059998.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MASRGRRPEHGGPPELFYDETEARKYVRNSRMIDIQTRMAGRALELLYLPENKPCYLLDIGCGTGLSGSYLSDEGHYWVGLDISPAMLDEAVDREIEGDLLLGDMGQGIP
RUO
WBSCR22
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
114049
WBSCR22 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HASJ4442|HUSSY-3|MGC19709|MGC2022|MGC5140|PP3381|WBMT
WBSCR22
Yes
Videos
SDS
Documents