Learn More
Abnova™ Human YAP1 Partial ORF (NP_006097, 53 a.a. - 161 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010413-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. [provided by RefSeq]
Sequence: QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRSpecifications
| NP_006097 | |
| Liquid | |
| 10413 | |
| YAP1 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| YAP/YAP2/YAP65/YKI | |
| YAP1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.73kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR | |
| RUO | |
| YAP1 | |
| Wheat Germ (in vitro) | |
| GST |