missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZBP1 Partial ORF (NP_110403.1, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00081030-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120377

  • 3860.70 SEK / 10µg
Estimated Shipment: 27-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

DLM1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.[supplied by OMIM]

Sequence: AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET
Specifications

Specifications

NP_110403.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAKRPQQHAATIPET
RUO
ZBP1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
81030
ZBP1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C20orf183/DAI/DLM-1/DLM1
ZBP1
Yes
Videos
SDS
Documents
Certificates
Special Offers

Special Offers