missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZBTB7B Partial ORF (NP_056956.1, 433 a.a. - 537 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051043-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136546

  • 5030.41 SEK / 25µg

Estimated Shipment: 06-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.[supplied by OMIM]

Sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
Specifications

Specifications

NP_056956.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME
RUO
ZBTB7B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51043
ZBTB7B (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp686G01254/THPOK/ZBTB15/ZFP67/ZNF857B/c-Krox/hcKrox
ZBTB7B
Yes
Videos
SDS
Documents
Certificates