missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZNF213 Partial ORF (NP_004211, 133 a.a. - 242 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
4515.00 SEK - 6845.00 SEK
Specifications
| Accession Number | NP_004211 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 7760 |
| Molecular Weight (g/mol) | 37.84kDa |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16127925
|
Abnova™
H00007760-Q01.25UG |
25 ug |
6845.00 SEK
25µg |
Estimated Shipment: 22-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16117925
|
Abnova™
H00007760-Q01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 22-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.[supplied by OMIM]
Sequence: QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGFSpecifications
| NP_004211 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.84kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CR53/ZKSCAN21 | |
| ZNF213 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 7760 | |
| ZNF213 (Human) Recombinant Protein (Q01) | |
| QDVPSEEAEPEAAGRGSQATGPPPTVGARRRPSVPQEQHSHSAQPPALLKEGRPGETTDTCFVSGVHGPVALGDIPFYFSREEWGTLDPAQRDLFWDIKRENSRNTTLGF | |
| RUO | |
| ZNF213 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |