missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF365 Partial ORF (NP_055766, 147 a.a. - 219 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00022891-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16184226

  • 5030.41 SEK / 25µg

Estimated Shipment: 02-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALN
Specifications

Specifications

NP_055766
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.77kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRERALN
RUO
ZNF365
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
22891
ZNF365 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0844/MGC41821/MGC87345/Su48/UAN/ZNF365D
ZNF365
Yes
Videos
SDS
Documents
Certificates