missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF385 Partial ORF (NP_056296.1, 1 a.a. - 99 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00025946-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16185226

  • 3343.96 SEK / 10µg

Estimated Shipment: 03-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Zinc finger proteins, such as ZNF385A, are regulatory proteins that act as transcription factors, bind single- or double-stranded RNA, or interact with other proteins (Sharma et al., 2004 [PubMed 15527981]).[supplied by OMIM]

Sequence: MQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVRE
Specifications

Specifications

NP_056296.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MQPPLDLKQILPFPLEPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNSQSQAEAHYKGNRHARRVKGIEAAKTRGREPGVRE
RUO
ZNF385A
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
25946
ZNF385 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp586G1122/HZF/RZF/ZFP385/ZNF385
ZNF385A
Yes
Videos
SDS
Documents
Certificates