missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZNF444 Partial ORF (NP_060807.2, 38 a.a. - 133 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00055311-Q01.25ug
Additional Details : Weight : 0.02000kg
Description
ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM]
Sequence: LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMISpecifications
| NP_060807.2 | |
| Liquid | |
| 55311 | |
| ZNF444 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EZF-2/EZF2/FLJ11137/ZSCAN17 | |
| ZNF444 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.3kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LGLLRALCRDWLRPEVHTKEQMLELLVLEQFLSALPADTQAWVCSRQPQSGEEAVALLEELWGPAASPDGSSATRVPQDVTQGPGATGGKEDSGMI | |
| RUO | |
| ZNF444 | |
| Wheat Germ (in vitro) | |
| GST |