missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZNF614 Full-length ORF (ENSP00000348674, 1 a.a. - 198 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
3970.00 SEK - 6025.00 SEK
Specifications
| Accession Number | ENSP00000348674 |
|---|---|
| For Use With (Application) | Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) |
| Format | Liquid |
| Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 80110 |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16144763
|
Abnova™
H00080110-P01.25UG |
25 ug |
6025.00 SEK
25µg |
Estimated Shipment: 04-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
16134763
|
Abnova™
H00080110-P01.10UG |
10 ug |
3970.00 SEK
10µg |
Estimated Shipment: 04-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
Descripción
Sequence: MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGETGSLERPRQADHLRSEVQDQPGQRGETLCLLKIHTKNEspecificaciones
| ENSP00000348674 | |
| Liquid | |
| 80110 | |
| ZNF614 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ21941/MGC120638 | |
| ZNF614 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 49.2kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKLAHGQEPWTTDAKIQNKNCPGIGKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVHLSKTHFPIVQNHDTFDLYRKNLKSSLSLINQKRRHGINNPVEFIGETGSLERPRQADHLRSEVQDQPGQRGETLCLLKIHTKN | |
| RUO | |
| ZNF614 | |
| Wheat Germ (in vitro) | |
| GST |