missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ IL1RN (Human) Recombinant Protein

Human IL1RN full-length ORF ( AAH09745, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00003557-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16116751

  • 4055.00 SEK / 10µg
Estimated Shipment: 10-06-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Specifications

Specifications

AAH09745
interleukin 1 receptor antagonist
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
IL1RN
GST
3557
Wheat germ expression system
10 μg
ICIL-1RA, IL-1ra3, IL1F3, IL1RA, IRAP, MGC10430
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers